Lineage for d1cpua1 (1cpu A:404-496)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17291Protein Animal alpha-amylase [51024] (3 species)
  7. 17292Species Human (Homo sapiens) [TaxId:9606] [51026] (5 PDB entries)
  8. 17296Domain d1cpua1: 1cpu A:404-496 [27771]
    Other proteins in same PDB: d1cpua2

Details for d1cpua1

PDB Entry: 1cpu (more details), 2 Å

PDB Description: subsite mapping of the active site of human pancreatic alpha-amylase using substrates, the pharmacological inhibitor acarbose, and an active site variant

SCOP Domain Sequences for d1cpua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cpua1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

SCOP Domain Coordinates for d1cpua1:

Click to download the PDB-style file with coordinates for d1cpua1.
(The format of our PDB-style files is described here.)

Timeline for d1cpua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1cpua2