SCOPe 2.08: Domain d4zb6b2: 4zb6 B:94-221

Lineage for d4zb6b2 (4zb6 B:94-221)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d4zb6b2: 4zb6 B:94-221 [277704]
   Other proteins in same PDB: d4zb6a1, d4zb6b1, d4zb6c1, d4zb6d1
   automated match to d4l8ea2
   complexed with gds, na

Details for d4zb6b2

PDB Entry: 4zb6, 1.8 Å

PDB Description: crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione.

PDB Compounds: (B:) PcUre2p4

SCOPe Domain Sequences for d4zb6b2:

Sequence; same for both SEQRES and ATOM records:

>d4zb6b2 a.45.1.0 (B:94-221) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vapgtneyytqlqwlyfqasgqgpyygqaawfsvyhpekipsaieryrneikrvlgvles
tlskqewlvgnkatvadfsfltwndiaanlllenfrfeeefpatakwnkkllerpaiakv
weekakaa

Timeline for d4zb6b2:

• d4zb6b2 first appeared in SCOPe 2.05
  
• d4zb6b2 appears in SCOPe 2.07