SCOPe 2.08: Domain d4zb6c1: 4zb6 C:5-93

Lineage for d4zb6c1 (4zb6 C:5-93)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.0: automated matches [191312] (1 protein)
   not a true family

6. Protein automated matches [190056] (195 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)

8. Domain d4zb6c1: 4zb6 C:5-93 [277701]
   Other proteins in same PDB: d4zb6a2, d4zb6b2, d4zb6c2, d4zb6d2
   automated match to d4l8ea1
   complexed with gds, na

Details for d4zb6c1

PDB Entry: 4zb6, 1.8 Å

PDB Description: crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione.

PDB Compounds: (C:) PcUre2p4

SCOPe Domain Sequences for d4zb6c1:

Sequence; same for both SEQRES and ATOM records:

>d4zb6c1 c.47.1.0 (C:5-93) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythnsgpngwkvaivleelglsyepvfldlmkgehkapeylkinpngrvpalid
hknnnytvwesnavtqylvdkydndrkis

Timeline for d4zb6c1:

• d4zb6c1 first appeared in SCOPe 2.05
  
• d4zb6c1 appears in SCOPe 2.07