Lineage for d4zb6c1 (4zb6 C:5-93)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2878967Family c.47.1.0: automated matches [191312] (1 protein)
    not a true family
  6. 2878968Protein automated matches [190056] (195 species)
    not a true protein
  7. 2879185Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries)
  8. 2879196Domain d4zb6c1: 4zb6 C:5-93 [277701]
    Other proteins in same PDB: d4zb6a2, d4zb6b2, d4zb6c2, d4zb6d2
    automated match to d4l8ea1
    complexed with gds, na

Details for d4zb6c1

PDB Entry: 4zb6 (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione.
PDB Compounds: (C:) PcUre2p4

SCOPe Domain Sequences for d4zb6c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zb6c1 c.47.1.0 (C:5-93) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
gkqftlythnsgpngwkvaivleelglsyepvfldlmkgehkapeylkinpngrvpalid
hknnnytvwesnavtqylvdkydndrkis

SCOPe Domain Coordinates for d4zb6c1:

Click to download the PDB-style file with coordinates for d4zb6c1.
(The format of our PDB-style files is described here.)

Timeline for d4zb6c1: