Lineage for d4zb6a2 (4zb6 A:94-222)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2321892Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2321893Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2322778Family a.45.1.0: automated matches [227130] (1 protein)
    not a true family
  6. 2322779Protein automated matches [226831] (65 species)
    not a true protein
  7. 2322810Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)
  8. 2322819Domain d4zb6a2: 4zb6 A:94-222 [277700]
    Other proteins in same PDB: d4zb6a1, d4zb6b1, d4zb6c1, d4zb6d1
    automated match to d4l8ea2
    complexed with gds, na

Details for d4zb6a2

PDB Entry: 4zb6 (more details), 1.8 Å

PDB Description: crystal structure of glutathione transferase ure2p4 from phanerochaete chrysosporium in complex with oxidized glutathione.
PDB Compounds: (A:) PcUre2p4

SCOPe Domain Sequences for d4zb6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4zb6a2 a.45.1.0 (A:94-222) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
vapgtneyytqlqwlyfqasgqgpyygqaawfsvyhpekipsaieryrneikrvlgvles
tlskqewlvgnkatvadfsfltwndiaanlllenfrfeeefpatakwnkkllerpaiakv
weekakaaa

SCOPe Domain Coordinates for d4zb6a2:

Click to download the PDB-style file with coordinates for d4zb6a2.
(The format of our PDB-style files is described here.)

Timeline for d4zb6a2: