SCOP 1.67: Domain d1bsi_1: 1bsi 404-496

Lineage for d1bsi_1 (1bsi 404-496)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (20 PDB entries)

8. Domain d1bsi_1: 1bsi 404-496 [27770]
   Other proteins in same PDB: d1bsi_2
   complexed with ca, cl, nag

Details for d1bsi_1

PDB Entry: 1bsi, 2 Å

PDB Description: human pancreatic alpha-amylase from pichia pastoris, glycosylated protein

SCOP Domain Sequences for d1bsi_1:

Sequence; same for both SEQRES and ATOM records:

>d1bsi_1 b.71.1.1 (404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1bsi_1:

• d1bsi_1 first appeared (with stable ids) in SCOP 1.55
  
• d1bsi_1 appears in SCOP 1.65
  
• d1bsi_1 appears in SCOP 1.69
  
• d1bsi_1 appears in the current release, SCOPe 2.08, called d1bsia1