Lineage for d1bsi_1 (1bsi 404-496)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Animal alpha-amylase [51024] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [51026] (5 PDB entries) 
Domain d1bsi_1: 1bsi 404-496 [27770]
Other proteins in same PDB: d1bsi_2
Details for d1bsi_1
PDB Entry: 1bsi (more details), 2 Å
PDB Description: human pancreatic alpha-amylase from pichia pastoris, glycosylated protein
SCOP Domain Sequences for d1bsi_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsi_1 b.71.1.1 (404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
SCOP Domain Coordinates for d1bsi_1:
Click to download the PDB-style file with coordinates for d1bsi_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bsi_1:
- d1bsi_1 appears in SCOP 1.57
- d1bsi_1 appears in the current release, SCOPe 2.08, called d1bsia1
View in 3D
