| Class b: All beta proteins [48724] (180 folds) |
| Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
| Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins) this domain follows the catalytic beta/alpha barrel domain |
| Protein Animal alpha-amylase [51024] (3 species) |
| Species Human (Homo sapiens) [TaxId:9606] [51026] (55 PDB entries) Uniprot P04746 16-511 ! SQ 04746 |
| Domain d1bsia1: 1bsi A:404-496 [27770] Other proteins in same PDB: d1bsia2, d1bsia3 complexed with ca, cl, nag |
PDB Entry: 1bsi (more details), 2 Å
SCOPe Domain Sequences for d1bsia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bsia1 b.71.1.1 (A:404-496) Animal alpha-amylase {Human (Homo sapiens) [TaxId: 9606]}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
Timeline for d1bsia1: