SCOPe 2.08: Domain d4zbad2: 4zba D:96-223

Lineage for d4zbad2 (4zba D:96-223)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.0: automated matches [227130] (1 protein)
   not a true family

6. Protein automated matches [226831] (73 species)
   not a true protein

7. Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226686] (9 PDB entries)

8. Domain d4zbad2: 4zba D:96-223 [277698]
   Other proteins in same PDB: d4zbaa1, d4zbab1, d4zbac1, d4zbad1
   automated match to d1k0da1
   complexed with act, cl, gds

Details for d4zbad2

PDB Entry: 4zba, 1.5 Å

PDB Description: crystal structure of the glutathione transferase ure2p8 from phanerochaete chrysosporium with oxidized glutathione.

PDB Compounds: (D:) PcUre2p8

SCOPe Domain Sequences for d4zbad2:

Sequence; same for both SEQRES and ATOM records:

>d4zbad2 a.45.1.0 (D:96-223) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
pgtddfyiqlqwqyfqgtgqgpyfgqlvwftlyheekipsavtrykeealrvfsvlervl
snqewlvggkmtiadisfvswndmivhfldnfdfekefpataawhykmlkrptikrpwde
rrklmsrq

Timeline for d4zbad2:

• d4zbad2 first appeared in SCOPe 2.05
  
• d4zbad2 appears in SCOPe 2.07