| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.47: Thioredoxin fold [52832] (2 superfamilies) core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest |
Superfamily c.47.1: Thioredoxin-like [52833] (24 families) ![]() |
| Family c.47.1.0: automated matches [191312] (1 protein) not a true family |
| Protein automated matches [190056] (195 species) not a true protein |
| Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [226685] (10 PDB entries) |
| Domain d4zbaa1: 4zba A:2-95 [277692] Other proteins in same PDB: d4zbaa2, d4zbab2, d4zbac2, d4zbad2 automated match to d1k0ba2 complexed with act, cl, gds |
PDB Entry: 4zba (more details), 1.5 Å
SCOPe Domain Sequences for d4zbaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4zbaa1 c.47.1.0 (A:2-95) automated matches {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]}
ashdkqfslflhkasahgwkvafvleelslsyeivlvdvakneqkspefmklnpngrtpa
lidhgnsdfviwesnamvqyvadkydterkisma
Timeline for d4zbaa1: