SCOP 1.57: Domain d1hny_1: 1hny 404-496

Lineage for d1hny_1 (1hny 404-496)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)

4. Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (11 proteins)

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [51026] (10 PDB entries)

8. Domain d1hny_1: 1hny 404-496 [27769]
   Other proteins in same PDB: d1hny_2

Details for d1hny_1

PDB Entry: 1hny, 1.8 Å

PDB Description: the structure of human pancreatic alpha-amylase at 1.8 angstroms resolution and comparisons with related enzymes

SCOP Domain Sequences for d1hny_1:

Sequence; same for both SEQRES and ATOM records:

>d1hny_1 b.71.1.1 (404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwsfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl

Timeline for d1hny_1:

• d1hny_1 first appeared (with stable ids) in SCOP 1.55
  
• d1hny_1 appears in SCOP 1.59
  
• d1hny_1 appears in the current release, SCOPe 2.08, called d1hnya1