SCOPe 2.08: Domain d4yjta_: 4yjt A:

Lineage for d4yjta_ (4yjt A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Tyrosine-protein kinase SYK [118131] (1 species)
   PTK group; SYK/ZAP-70 subfamily; non-membrane spanning protein tyrosine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [118132] (73 PDB entries)
   Uniprot P43405 363-635 # structure of the SH2 domain tandem region (9-265) is also known (55576)

8. Domain d4yjta_: 4yjt A: [277684]
   automated match to d3tuca_
   complexed with 4dq, gol

Details for d4yjta_

PDB Entry: 4yjt, 1.52 Å

PDB Description: the kinase domain of human spleen tyrosine (syk) in complex with gtc000233

PDB Compounds: (A:) Tyrosine-protein kinase SYK

SCOPe Domain Sequences for d4yjta_:

Sequence; same for both SEQRES and ATOM records:

>d4yjta_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]}
yldrklltledkelgsgnfgtvkkgyyqmkkvvktvavkilkneandpalkdellaeanv
mqqldnpyivrmigiceaeswmlvmemaelgplnkylqqnrhvkdkniielvhqvsmgmk
yleesnfvhrdlaarnvllvtqhyakisdfglskalradenyykaqthgkwpvkwyapec
inyykfssksdvwsfgvlmweafsygqkpyrgmkgsevtamlekgermgcpagcpremyd
lmnlcwtydvenrpgfaavelrlrnyyydv

Timeline for d4yjta_:

• d4yjta_ first appeared in SCOPe 2.05
  
• d4yjta_ appears in SCOPe 2.07