Lineage for d1smd_1 (1smd 404-496)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Animal alpha-amylase [51024] (3 species) 
Species Human (Homo sapiens) [TaxId:9606] [51026] (5 PDB entries) 
Domain d1smd_1: 1smd 404-496 [27768]
Other proteins in same PDB: d1smd_2
Details for d1smd_1
PDB Entry: 1smd (more details), 1.6 Å
PDB Description: human salivary amylase
SCOP Domain Sequences for d1smd_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1smd_1 b.71.1.1 (404-496) Animal alpha-amylase {Human (Homo sapiens)}
qpftnwydngsnqvafgrgnrgfivfnnddwtfsltlqtglpagtycdvisgdkingnct
gikiyvsddgkahfsisnsaedpfiaihaeskl
SCOP Domain Coordinates for d1smd_1:
Click to download the PDB-style file with coordinates for d1smd_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1smd_1:
- d1smd_1 appears in SCOP 1.57
- d1smd_1 appears in the current release, SCOPe 2.08, called d1smda1
View in 3D
