Lineage for d4yg6b_ (4yg6 B:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782111Species Rotavirus a [TaxId:10930] [277672] (2 PDB entries)
  8. 1782113Domain d4yg6b_: 4yg6 B: [277676]
    automated match to d4drva_
    complexed with bgc, gal, nag, po4

Details for d4yg6b_

PDB Entry: 4yg6 (more details), 1.46 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses
PDB Compounds: (B:) Outer capsid protein VP8*

SCOPe Domain Sequences for d4yg6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yg6b_ b.29.1.0 (B:) automated matches {Rotavirus a [TaxId: 10930]}
gsldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvm
netvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadt
qgdlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl

SCOPe Domain Coordinates for d4yg6b_:

Click to download the PDB-style file with coordinates for d4yg6b_.
(The format of our PDB-style files is described here.)

Timeline for d4yg6b_:

  • d4yg6b_ appears in periodic updates to SCOPe 2.05 starting on 2015-09-30
  • d4yg6b_ is called d4yg6b1 in SCOPe 2.06
  • d4yg6b_ appears in the current release, SCOPe 2.07, called d4yg6b1