Lineage for d4yg6b1 (4yg6 B:65-225)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2780621Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2780622Protein automated matches [190437] (70 species)
    not a true protein
  7. 2781263Species Rotavirus a [TaxId:10930] [277672] (2 PDB entries)
  8. 2781265Domain d4yg6b1: 4yg6 B:65-225 [277676]
    Other proteins in same PDB: d4yg6a2, d4yg6b2, d4yg6c2, d4yg6d2
    automated match to d4drva_
    complexed with po4

Details for d4yg6b1

PDB Entry: 4yg6 (more details), 1.46 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses
PDB Compounds: (B:) Outer capsid protein VP8*

SCOPe Domain Sequences for d4yg6b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yg6b1 b.29.1.0 (B:65-225) automated matches {Rotavirus a [TaxId: 10930]}
ldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvmne
tvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadtqg
dlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl

SCOPe Domain Coordinates for d4yg6b1:

Click to download the PDB-style file with coordinates for d4yg6b1.
(The format of our PDB-style files is described here.)

Timeline for d4yg6b1: