Lineage for d4yg3a1 (4yg3 A:65-225)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (55 species)
    not a true protein
  7. 2375604Species Rotavirus a [TaxId:10930] [277672] (2 PDB entries)
  8. 2375609Domain d4yg3a1: 4yg3 A:65-225 [277674]
    Other proteins in same PDB: d4yg3a2
    automated match to d4drva_
    complexed with so4

Details for d4yg3a1

PDB Entry: 4yg3 (more details), 2.29 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4yg3a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yg3a1 b.29.1.0 (A:65-225) automated matches {Rotavirus a [TaxId: 10930]}
ldgpyapdssnlpsncwylvnpsndgvvfsvtdnstfwmftylvlpntaqtnvtvnvmne
tvnisidnsgstyrfvdyiktsstqaygsrnylntahrlqayrrdgdgnisnywgadtqg
dlrvgtysnpvpnavinlnadfyvipdsqqetcteyirggl

SCOPe Domain Coordinates for d4yg3a1:

Click to download the PDB-style file with coordinates for d4yg3a1.
(The format of our PDB-style files is described here.)

Timeline for d4yg3a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4yg3a2