Lineage for d1bvnp1 (1bvn P:404-496)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2076868Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2076869Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2076870Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2076899Protein Animal alpha-amylase [51024] (3 species)
  7. 2076954Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)
  8. 2076973Domain d1bvnp1: 1bvn P:404-496 [27767]
    Other proteins in same PDB: d1bvnp2, d1bvnt_
    complexed with ca, cl

Details for d1bvnp1

PDB Entry: 1bvn (more details), 2.5 Å

PDB Description: pig pancreatic alpha-amylase in complex with the proteinaceous inhibitor tendamistat
PDB Compounds: (P:) protein (alpha-amylase)

SCOPe Domain Sequences for d1bvnp1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bvnp1 b.71.1.1 (P:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
qpfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycnvisgdkvgnsct
gikvyvssdgtaqfsisnsaqdpfiaihaeskl

SCOPe Domain Coordinates for d1bvnp1:

Click to download the PDB-style file with coordinates for d1bvnp1.
(The format of our PDB-style files is described here.)

Timeline for d1bvnp1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bvnp2
View in 3D
Domains from other chains:
(mouse over for more information)
d1bvnt_