Lineage for d4yfwa_ (4yfw A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1779936Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1779937Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1781809Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 1781810Protein automated matches [190437] (37 species)
    not a true protein
  7. 1782126Species Rotavirus a [TaxId:28875] [277665] (1 PDB entry)
  8. 1782127Domain d4yfwa_: 4yfw A: [277666]
    automated match to d3taya_

Details for d4yfwa_

PDB Entry: 4yfw (more details), 1.66 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses
PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4yfwa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4yfwa_ b.29.1.0 (A:) automated matches {Rotavirus a [TaxId: 28875]}
ldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnvmne
tvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgsstyg
dlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl

SCOPe Domain Coordinates for d4yfwa_:

Click to download the PDB-style file with coordinates for d4yfwa_.
(The format of our PDB-style files is described here.)

Timeline for d4yfwa_:

View in 3D
Domains from other chains:
(mouse over for more information)
d4yfwb_