SCOPe 2.08: Domain d4yfwa_: 4yfw A:

Lineage for d4yfwa_ (4yfw A:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families)

5. Family b.29.1.0: automated matches [191363] (1 protein)
   not a true family

6. Protein automated matches [190437] (70 species)
   not a true protein

7. Species Rotavirus a [TaxId:28875] [277665] (11 PDB entries)

8. Domain d4yfwa_: 4yfw A: [277666]
   automated match to d3taya_

Details for d4yfwa_

PDB Entry: 4yfw, 1.66 Å

PDB Description: structural basis of glycan recognition in neonate-specific rotaviruses

PDB Compounds: (A:) Outer capsid protein VP4

SCOPe Domain Sequences for d4yfwa_:

Sequence; same for both SEQRES and ATOM records:

>d4yfwa_ b.29.1.0 (A:) automated matches {Rotavirus a [TaxId: 28875]}
ldgpytpdssnlpsnywylinplndgvvfsvtnnstfwmftylilpntaqtnvtvnvmne
tvnisidnsgstyrfvdyfktsstqsyrqrnylitehrlqayrrdesgnisnywgsstyg
dlrvgtyfnpvlnavinlnadfyiipdsqqekcteyikggl

Timeline for d4yfwa_:

• d4yfwa_ first appeared in SCOPe 2.05
  
• d4yfwa_ appears in SCOPe 2.07