SCOP 1.65: Domain d1ose_1: 1ose 404-496

Lineage for d1ose_1 (1ose 404-496)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (2 families)

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (19 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (11 PDB entries)

8. Domain d1ose_1: 1ose 404-496 [27766]
   Other proteins in same PDB: d1ose_2
   complexed with acr, ca, cl, glc

Details for d1ose_1

PDB Entry: 1ose, 2.3 Å

PDB Description: porcine pancreatic alpha-amylase complexed with acarbose

SCOP Domain Sequences for d1ose_1:

Sequence; same for both SEQRES and ATOM records:

>d1ose_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1ose_1:

• d1ose_1 first appeared (with stable ids) in SCOP 1.55
  
• d1ose_1 appears in SCOP 1.63
  
• d1ose_1 appears in SCOP 1.67
  
• d1ose_1 appears in the current release, SCOPe 2.08, called d1osea1