| Class b: All beta proteins [48724] (176 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein automated matches [190374] (14 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187221] (409 PDB entries) |
| Domain d4wi4a1: 4wi4 A:240-339 [277652] Other proteins in same PDB: d4wi4a2, d4wi4b2 automated match to d2j6ea1 complexed with bma, edo, fuc, man, nag; mutant |
PDB Entry: 4wi4 (more details), 2.8 Å
SCOPe Domain Sequences for d4wi4a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wi4a1 b.1.1.2 (A:240-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vflfppkpkdtlmiartpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqynst
yrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d4wi4a1: