Lineage for d4xpva_ (4xpv A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2374612Family b.29.1.11: Xylanase/endoglucanase 11/12 [49978] (3 protein domains)
  6. 2374657Protein Xylanase II [49979] (19 species)
    Partial overlap with common fold and the active sites of the other endoglucanases
  7. 2374731Species Hypocrea jecorina [TaxId:51453] [277348] (4 PDB entries)
  8. 2374736Domain d4xpva_: 4xpv A: [277641]
    automated match to d2jica_
    complexed with dod, iod

Details for d4xpva_

PDB Entry: 4xpv (more details), 1.7 Å

PDB Description: neutron and x-ray structure analysis of xylanase: n44d at ph6
PDB Compounds: (A:) Endo-1,4-beta-xylanase 2

SCOPe Domain Sequences for d4xpva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xpva_ b.29.1.11 (A:) Xylanase II {Hypocrea jecorina [TaxId: 51453]}
tiqpgtgynngyfysywndghggvtytngpggqfsvnwsnsgdfvggkgwqpgtknkvin
fsgsynpngnsylsvygwsrnplieyyivenfgtynpstgatklgevtsdgsvydiyrtq
rvnqpsiigtatfyqywsvrrnhrssgsvntanhfnawaqqgltlgtmdyqivavegyfs
sgsasitvs

SCOPe Domain Coordinates for d4xpva_:

Click to download the PDB-style file with coordinates for d4xpva_.
(The format of our PDB-style files is described here.)

Timeline for d4xpva_: