Lineage for d4xhua2 (4xhu A:797-1012)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1939878Fold d.166: ADP-ribosylation [56398] (1 superfamily)
    unusual fold
  4. 1939879Superfamily d.166.1: ADP-ribosylation [56399] (8 families) (S)
  5. 1940165Family d.166.1.0: automated matches [191650] (1 protein)
    not a true family
  6. 1940166Protein automated matches [191197] (7 species)
    not a true protein
  7. 1940202Species Human (Homo sapiens) [TaxId:9606] [225406] (26 PDB entries)
  8. 1940227Domain d4xhua2: 4xhu A:797-1012 [277637]
    Other proteins in same PDB: d4xhua1, d4xhuc1
    automated match to d4hhyd2
    protein/DNA complex; complexed with act, ca, gol

Details for d4xhua2

PDB Entry: 4xhu (more details), 2.09 Å

PDB Description: the complex structure of timeless_pab and parp-1_catalytic domain
PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4xhua2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4xhua2 d.166.1.0 (A:797-1012) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkts

SCOPe Domain Coordinates for d4xhua2:

Click to download the PDB-style file with coordinates for d4xhua2.
(The format of our PDB-style files is described here.)

Timeline for d4xhua2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4xhua1