SCOPe 2.05: Domain d4xhua2: 4xhu A:797-1012

Lineage for d4xhua2 (4xhu A:797-1012)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.166: ADP-ribosylation [56398] (1 superfamily)
   unusual fold

4. Superfamily d.166.1: ADP-ribosylation [56399] (8 families)

5. Family d.166.1.0: automated matches [191650] (1 protein)
   not a true family

6. Protein automated matches [191197] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225406] (26 PDB entries)

8. Domain d4xhua2: 4xhu A:797-1012 [277637]
   Other proteins in same PDB: d4xhua1, d4xhuc1
   automated match to d4hhyd2
   protein/DNA complex; complexed with act, ca, gol

Details for d4xhua2

PDB Entry: 4xhu, 2.09 Å

PDB Description: the complex structure of timeless_pab and parp-1_catalytic domain

PDB Compounds: (A:) Poly [ADP-ribose] polymerase 1

SCOPe Domain Sequences for d4xhua2:

Sequence; same for both SEQRES and ATOM records:

>d4xhua2 d.166.1.0 (A:797-1012) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lktdikvvdrdseeaeiirkyvknthatthnaydlevidifkieregecqrykpfkqlhn
rrllwhgsrttnfagilsqglriappeapvtgymfgkgiyfadmvsksanychtsqgdpi
glillgevalgnmyelkhashisklpkgkhsvkglgkttpdpsanisldgvdvplgtgis
sgvndtsllyneyivydiaqvnlkyllklkfnfkts

Timeline for d4xhua2:

• d4xhua2 is new in SCOPe 2.05-stable
  
• d4xhua2 appears in SCOPe 2.06
  
• d4xhua2 appears in the current release, SCOPe 2.08