![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.41: Domain of poly(ADP-ribose) polymerase [47586] (1 superfamily) core: 4 helices: bundle; unusual topology |
![]() | Superfamily a.41.1: Domain of poly(ADP-ribose) polymerase [47587] (2 families) ![]() duplication: consists of 2 helix-loop-helix structural repeats automatically mapped to Pfam PF02877 |
![]() | Family a.41.1.0: automated matches [227223] (1 protein) not a true family |
![]() | Protein automated matches [226964] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [225405] (62 PDB entries) |
![]() | Domain d4xhua1: 4xhu A:661-796 [277636] Other proteins in same PDB: d4xhua2, d4xhuc2 automated match to d4hhyd1 protein/DNA complex; complexed with act, ca, gol |
PDB Entry: 4xhu (more details), 2.09 Å
SCOPe Domain Sequences for d4xhua1:
Sequence, based on SEQRES records: (download)
>d4xhua1 a.41.1.0 (A:661-796) automated matches {Human (Homo sapiens) [TaxId: 9606]} tksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav sqgssdsqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrg gsddsskdpidvnyek
>d4xhua1 a.41.1.0 (A:661-796) automated matches {Human (Homo sapiens) [TaxId: 9606]} tksklpkpvqdlikmifdvesmkkamveyeidlqkmplgklskrqiqaaysilsevqqav sqildlsnrfytliphdfgmkkppllnnadsvqakvemldnlldievaysllrsskdpid vnyek
Timeline for d4xhua1: