SCOP 1.73: Domain d1ppia1: 1ppi A:404-496

Lineage for d1ppia1 (1ppi A:404-496)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (14 PDB entries)

8. Domain d1ppia1: 1ppi A:404-496 [27763]
   Other proteins in same PDB: d1ppia2
   complexed with ca, cl, daf, glc

Details for d1ppia1

PDB Entry: 1ppi, 2.2 Å

PDB Description: the active center of a mammalian alpha-amylase. the structure of the complex of a pancreatic alpha-amylase with a carbohydrate inhibitor refined to 2.2 angstroms resolution

PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1ppia1:

Sequence; same for both SEQRES and ATOM records:

>d1ppia1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1ppia1:

• d1ppia1 first appeared (with stable ids) in SCOP 1.55, called d1ppi_1
  
• d1ppia1 was called d1ppi_1 in SCOP 1.71
  
• d1ppia1 appears in SCOP 1.75
  
• d1ppia1 appears in the current release, SCOPe 2.08