Lineage for d4wi8a1 (4wi8 A:237-339)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361216Protein automated matches [190374] (17 species)
    not a true protein
  7. 2361253Species Human (Homo sapiens) [TaxId:9606] [187221] (1235 PDB entries)
  8. 2363244Domain d4wi8a1: 4wi8 A:237-339 [277620]
    Other proteins in same PDB: d4wi8a2, d4wi8b2
    automated match to d2j6ea1
    complexed with bma, fuc, man, nag; mutant

Details for d4wi8a1

PDB Entry: 4wi8 (more details), 2.8 Å

PDB Description: structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation y436a
PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4wi8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4wi8a1 b.1.1.2 (A:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska

SCOPe Domain Coordinates for d4wi8a1:

Click to download the PDB-style file with coordinates for d4wi8a1.
(The format of our PDB-style files is described here.)

Timeline for d4wi8a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4wi8a2