Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein automated matches [190374] (16 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries) |
Domain d4wi8a1: 4wi8 A:237-339 [277620] Other proteins in same PDB: d4wi8a2, d4wi8b2 automated match to d2j6ea1 complexed with bma, fuc, man, nag; mutant |
PDB Entry: 4wi8 (more details), 2.8 Å
SCOPe Domain Sequences for d4wi8a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4wi8a1 b.1.1.2 (A:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]} gpsvflfppkpkdtlmisrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy nstyrvvsvltvlhqdwlngkeykckvsnkalpapiektiska
Timeline for d4wi8a1: