Lineage for d1jfha1 (1jfh A:404-496)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2419799Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2419800Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2419801Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 2419830Protein Animal alpha-amylase [51024] (3 species)
  7. 2419887Species Pig (Sus scrofa) [TaxId:9823] [51025] (13 PDB entries)
  8. 2419897Domain d1jfha1: 1jfh A:404-496 [27762]
    Other proteins in same PDB: d1jfha2
    complexed with ca, cl, glc, hg, ma1, ma2, ma3

Details for d1jfha1

PDB Entry: 1jfh (more details), 2.03 Å

PDB Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
PDB Compounds: (A:) alpha-amylase

SCOPe Domain Sequences for d1jfha1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1jfha1 b.71.1.1 (A:404-496) Animal alpha-amylase {Pig (Sus scrofa) [TaxId: 9823]}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

SCOPe Domain Coordinates for d1jfha1:

Click to download the PDB-style file with coordinates for d1jfha1.
(The format of our PDB-style files is described here.)

Timeline for d1jfha1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1jfha2