SCOP 1.71: Domain d1jfh_1: 1jfh 404-496

Lineage for d1jfh_1 (1jfh 404-496)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Animal alpha-amylase [51024] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [51025] (12 PDB entries)

8. Domain d1jfh_1: 1jfh 404-496 [27762]
   Other proteins in same PDB: d1jfh_2
   complexed with ca, cl, hg, ma1, ma2, ma3, man

Details for d1jfh_1

PDB Entry: 1jfh, 2.03 Å

PDB Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution

SCOP Domain Sequences for d1jfh_1:

Sequence; same for both SEQRES and ATOM records:

>d1jfh_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl

Timeline for d1jfh_1:

• d1jfh_1 first appeared (with stable ids) in SCOP 1.55
  
• d1jfh_1 appears in SCOP 1.69
  
• d1jfh_1 is called d1jfha1 in SCOP 1.73
  
• d1jfh_1 appears in the current release, SCOPe 2.08, called d1jfha1