Lineage for d1jfh_1 (1jfh 404-496)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily) Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) 
Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins) 
Protein Animal alpha-amylase [51024] (3 species) 
Species Pig (Sus scrofa) [TaxId:9823] [51025] (7 PDB entries) 
Domain d1jfh_1: 1jfh 404-496 [27762]
Other proteins in same PDB: d1jfh_2
Details for d1jfh_1
PDB Entry: 1jfh (more details), 2.03 Å
PDB Description: structure of a pancreatic alpha-amylase bound to a substrate analogue at 2.03 angstrom resolution
SCOP Domain Sequences for d1jfh_1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jfh_1 b.71.1.1 (404-496) Animal alpha-amylase {Pig (Sus scrofa)}
epfanwwdngsnqvafgrgnrgfivfnnddwqlsstlqtglpggtycdvisgdkvgnsct
gikvyvssdgtaqfsisnsaedpfiaihaeskl
SCOP Domain Coordinates for d1jfh_1:
Click to download the PDB-style file with coordinates for d1jfh_1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1jfh_1:
- d1jfh_1 appears in SCOP 1.57
- d1jfh_1 appears in the current release, SCOPe 2.08, called d1jfha1
View in 3D
