SCOPe 2.06: Domain d4wi9a1: 4wi9 A:237-339

Lineage for d4wi9a1 (4wi9 A:237-339)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (16 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)

8. Domain d4wi9a1: 4wi9 A:237-339 [277613]
   Other proteins in same PDB: d4wi9a2, d4wi9b2
   automated match to d2j6ea1
   complexed with bma, fuc, man, nag; mutant

Details for d4wi9a1

PDB Entry: 4wi9, 2.65 Å

PDB Description: structural mapping of the human igg1 binding site for fcrn: hu3s193 fc mutation i253a/h310a

PDB Compounds: (A:) Ig gamma-1 chain C region

SCOPe Domain Sequences for d4wi9a1:

Sequence; same for both SEQRES and ATOM records:

>d4wi9a1 b.1.1.2 (A:237-339) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gpsvflfppkpkdtlmasrtpevtcvvvdvshedpevkfnwyvdgvevhnaktkpreeqy
nstyrvvsvltvlaqdwlngkeykckvsnkalpapiektiska

Timeline for d4wi9a1:

• d4wi9a1 first appeared in SCOPe 2.05
  
• d4wi9a1 appears in SCOPe 2.07
  
• d4wi9a1 appears in the current release, SCOPe 2.08