Lineage for d4wdha_ (4wdh A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2956563Fold d.61: LigT-like [55143] (1 superfamily)
    duplication of beta-alpha-beta-alpha-beta motif: antiparallel beta sheet forms barrel (n=6, S=8) similar to the barrel of prokaryotic DNA topoisomerases I and III
  4. 2956564Superfamily d.61.1: LigT-like [55144] (5 families) (S)
  5. 2956578Family d.61.1.3: 2',3'-cyclic nucleotide 3'-phosphodiesterase, catalytic domain [103043] (2 proteins)
    automatically mapped to Pfam PF05881
  6. 2956583Protein automated matches [190813] (2 species)
    not a true protein
  7. 2956586Species Mouse (Mus musculus) [TaxId:10090] [189888] (31 PDB entries)
  8. 2956600Domain d4wdha_: 4wdh A: [277595]
    automated match to d2xmia_
    complexed with acy, cl; mutant

Details for d4wdha_

PDB Entry: 4wdh (more details), 1.9 Å

PDB Description: catalytic domain of mouse 2',3'-cyclic nucleotide 3'- phosphodiesterase, with mutation y168a
PDB Compounds: (A:) 2',3'-cyclic-nucleotide 3'-phosphodiesterase

SCOPe Domain Sequences for d4wdha_:

Sequence, based on SEQRES records: (download)

>d4wdha_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdflplafgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyf
gkrppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvl
tdqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkggsqge
avgelprgklyslgkgrwmlsltkkmevkaiftgyyg

Sequence, based on observed residues (ATOM records): (download)

>d4wdha_ d.61.1.3 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
kdflplafgwfltkkssetlrkagqvfleelgnhkafkkelrhfisgdepkeklelvsyf
gkrppgvlhcttkfcdygkaagaeeyaqqevvkrsygkafklsisalfvtpktagaqvvl
tdqelqlwpsdldkpsaseglppgsrahvtlgcaadvqpvqtgldlldilqqvkgeavge
lprgklyslgkgrwmlsltkkmevkaiftgyyg

SCOPe Domain Coordinates for d4wdha_:

Click to download the PDB-style file with coordinates for d4wdha_.
(The format of our PDB-style files is described here.)

Timeline for d4wdha_: