Class b: All beta proteins [48724] (177 folds) |
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) sandwich; 12-14 strands in 2 sheets; complex topology |
Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) |
Family b.29.1.10: Glycosyl hydrolase family 7 catalytic core [49971] (2 proteins) contains many insertions in the common fold automatically mapped to Pfam PF00840 |
Protein automated matches [190170] (17 species) not a true protein |
Species Trichoderma reesei [TaxId:334564] [270238] (2 PDB entries) |
Domain d4v0za_: 4v0z A: [277594] automated match to d1q2ba_ complexed with co, gol, nag, opo, peg |
PDB Entry: 4v0z (more details), 1.7 Å
SCOPe Domain Sequences for d4v0za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4v0za_ b.29.1.10 (A:) automated matches {Trichoderma reesei [TaxId: 334564]} esactlqsethppltwqkcssggtctqqtgsvvidanwrwthatnsstncydgntwsstl cpdnetcaknccldgaayastygvttsgnslsigfvtqsaqknvgarlylmasdttyqef tllgnefsfdvdvsqlpcglngalyfvsmdadggvskyptntagakygtgycdsqcprdl kfingqanvegwepssnnantgigghgsccsemdiweansisealtphpcttvgqeiceg dgcggtysdnryggtcdpdgcdwnpyrlgntsfygpgssftldttkkltvvtqfetsgai nryyvqdgvtfqqpnaelgsysgnelnddyctaeeaefggssfsdkggltqfkkatsggm vlvmslwddyyanmlwldstyptnetsstpgavrgscstssgvpaqvesqspnakvtfsn ikfgpigstgnpsg
Timeline for d4v0za_: