SCOPe 2.04: Domain d1ciua3: 1ciu A:407-495

Lineage for d1ciua3 (1ciu A:407-495)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (22 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId:33950] [51023] (4 PDB entries)

8. Domain d1ciua3: 1ciu A:407-495 [27759]
   Other proteins in same PDB: d1ciua1, d1ciua2, d1ciua4
   complexed with ca

Details for d1ciua3

PDB Entry: 1ciu, 2.3 Å

PDB Description: thermostable cgtase from thermoanaerobacterium thermosulfurigenes em1 at ph 8.0.

PDB Compounds: (A:) cyclodextrin glycosyltransferase

SCOPe Domain Sequences for d1ciua3:

Sequence; same for both SEQRES and ATOM records:

>d1ciua3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Thermoanaerobacterium thermosulfurigenes, EM1 [TaxId: 33950]}
gttqqrwinndvyiyerkfgnnvalvainrnlstsynitglytalpagtytdvlggllng
nsisvasdgsvtpftlsagevavwqyvss

Timeline for d1ciua3:

• d1ciua3 first appeared (with stable ids) in SCOP 1.55, called d1ciu_3
  
• d1ciua3 appears in SCOPe 2.03
  
• d1ciua3 appears in SCOPe 2.05
  
• d1ciua3 appears in the current release, SCOPe 2.08