| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies) 3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest |
Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) ![]() |
| Family c.51.1.0: automated matches [227929] (1 protein) not a true family |
| Protein automated matches [227930] (6 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [227931] (3 PDB entries) |
| Domain d4ttvd2: 4ttv D:612-723 [277582] Other proteins in same PDB: d4ttva1, d4ttva3, d4ttvb1, d4ttvb3, d4ttvc1, d4ttvc3, d4ttvd1, d4ttvd3 automated match to d4hwra2 protein/RNA complex; complexed with bc9, zn |
PDB Entry: 4ttv (more details), 2.8 Å
SCOPe Domain Sequences for d4ttvd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4ttvd2 c.51.1.0 (D:612-723) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeeef
Timeline for d4ttvd2: