SCOPe 2.05: Domain d4ttvd1: 4ttv D:321-611

Lineage for d4ttvd1 (4ttv D:321-611)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.0: automated matches [227172] (1 protein)
   not a true family

6. Protein automated matches [226887] (9 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225403] (8 PDB entries)

8. Domain d4ttvd1: 4ttv D:321-611 [277581]
   Other proteins in same PDB: d4ttva2, d4ttvb2, d4ttvc2, d4ttvd2
   automated match to d4hwra1
   protein/RNA complex; complexed with bc9, zn

Details for d4ttvd1

PDB Entry: 4ttv, 2.8 Å

PDB Description: crystal structure of human thrrs complexing with a bioengineered macrolide bc194

PDB Compounds: (D:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4ttvd1:

Sequence; same for both SEQRES and ATOM records:

>d4ttvd1 d.104.1.0 (D:321-611) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifns
rlwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvl
hrnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlst
rpekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcat
iqldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

Timeline for d4ttvd1:

• d4ttvd1 is new in SCOPe 2.05-stable
  
• d4ttvd1 appears in SCOPe 2.06
  
• d4ttvd1 appears in the current release, SCOPe 2.08