Lineage for d4ttvd1 (4ttv D:322-611)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2967616Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
    contains large mixed beta-sheet
  4. 2967617Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families) (S)
  5. 2968016Family d.104.1.0: automated matches [227172] (1 protein)
    not a true family
  6. 2968017Protein automated matches [226887] (24 species)
    not a true protein
  7. 2968077Species Human (Homo sapiens) [TaxId:9606] [225403] (12 PDB entries)
  8. 2968105Domain d4ttvd1: 4ttv D:322-611 [277581]
    Other proteins in same PDB: d4ttva2, d4ttva3, d4ttvb2, d4ttvb3, d4ttvc2, d4ttvc3, d4ttvd2, d4ttvd3
    automated match to d4hwra1
    protein/RNA complex; complexed with bc9, zn

Details for d4ttvd1

PDB Entry: 4ttv (more details), 2.8 Å

PDB Description: crystal structure of human thrrs complexing with a bioengineered macrolide bc194
PDB Compounds: (D:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4ttvd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttvd1 d.104.1.0 (D:322-611) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dhrkigrdqelyffhelspgscfflpkgayiynaliefirseyrkrgfqevvtpnifnsr
lwmtsghwqhysenmfsfevekelfalkpmncpghclmfdhrprswrelplrladfgvlh
rnelsgaltgltrvrrfqqddahifcameqiedeikgcldflrtvysvfgfsfklnlstr
pekflgdievwdqaekqlenslnefgekwelnsgdgafygpkidiqikdaigryhqcati
qldfqlpirfnltyvshdgddkkrpvivhrailgsvermiailtenyggk

SCOPe Domain Coordinates for d4ttvd1:

Click to download the PDB-style file with coordinates for d4ttvd1.
(The format of our PDB-style files is described here.)

Timeline for d4ttvd1: