Lineage for d1dedb3 (1ded B:407-496)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17324Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 17354Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (3 PDB entries)
  8. 17360Domain d1dedb3: 1ded B:407-496 [27758]
    Other proteins in same PDB: d1deda1, d1deda2, d1deda4, d1dedb1, d1dedb2, d1dedb4

Details for d1dedb3

PDB Entry: 1ded (more details), 2 Å

PDB Description: crystal structure of alkalophilic asparagine 233-replaced cyclodextrin glucanotransferase complexed with an inhibitor, acarbose, at 2.0 a resolution

SCOP Domain Sequences for d1dedb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dedb3 b.71.1.1 (B:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1dedb3:

Click to download the PDB-style file with coordinates for d1dedb3.
(The format of our PDB-style files is described here.)

Timeline for d1dedb3: