Lineage for d4ttvb2 (4ttv B:612-723)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2135875Fold c.51: Anticodon-binding domain-like [52953] (6 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of five strands, order 21345; strand 4 is antiparallel to the rest
  4. 2135876Superfamily c.51.1: Class II aaRS ABD-related [52954] (3 families) (S)
  5. 2135995Family c.51.1.0: automated matches [227929] (1 protein)
    not a true family
  6. 2135996Protein automated matches [227930] (3 species)
    not a true protein
  7. 2136016Species Human (Homo sapiens) [TaxId:9606] [227931] (3 PDB entries)
  8. 2136024Domain d4ttvb2: 4ttv B:612-723 [277575]
    Other proteins in same PDB: d4ttva1, d4ttva3, d4ttvb1, d4ttvb3, d4ttvc1, d4ttvc3, d4ttvd1, d4ttvd3
    automated match to d4hwra2
    protein/RNA complex; complexed with bc9, zn

Details for d4ttvb2

PDB Entry: 4ttv (more details), 2.8 Å

PDB Description: crystal structure of human thrrs complexing with a bioengineered macrolide bc194
PDB Compounds: (B:) Threonine--tRNA ligase, cytoplasmic

SCOPe Domain Sequences for d4ttvb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ttvb2 c.51.1.0 (B:612-723) automated matches {Human (Homo sapiens) [TaxId: 9606]}
wpfwlsprqvmvvpvgptcdeyaqkvrqqfhdakfmadidldpgctlnkkirnaqlaqyn
filvvgekekisgtvnirtrdnkvhgertisetierlqqlkefrskqaeeef

SCOPe Domain Coordinates for d4ttvb2:

Click to download the PDB-style file with coordinates for d4ttvb2.
(The format of our PDB-style files is described here.)

Timeline for d4ttvb2: