Lineage for d4rzib_ (4rzi B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848735Species Synechocystis sp. [TaxId:1148] [276989] (2 PDB entries)
  8. 2848739Domain d4rzib_: 4rzi B: [277571]
    automated match to d1ulud_

Details for d4rzib_

PDB Entry: 4rzi (more details), 2.89 Å

PDB Description: crystal structure of phab from synechocystis sp. pcc 6803
PDB Compounds: (B:) 3-ketoacyl-acyl carrier protein reductase

SCOPe Domain Sequences for d4rzib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rzib_ c.2.1.0 (B:) automated matches {Synechocystis sp. [TaxId: 1148]}
lslgledkvivvtggnrgigaaivkllqemgakvaftdlatdggntealgvvanvtdles
mtaaaaeitdklgpvygvvanagitkdnffpkltpadwdavlnvnlkgvaysikpfiegm
yerkagsivaissisgergnvgqtnysatkagvigmmkslaregarygvranavapgfid
temtlairedirekitkeipfrrfgkpeeiawavafllspvassyvtgevlrvngahht

SCOPe Domain Coordinates for d4rzib_:

Click to download the PDB-style file with coordinates for d4rzib_.
(The format of our PDB-style files is described here.)

Timeline for d4rzib_: