SCOPe 2.05: Domain d4rf5b_: 4rf5 B:

Lineage for d4rf5b_ (4rf5 B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Lactobacillus kefiri [TaxId:33962] [277547] (4 PDB entries)

8. Domain d4rf5b_: 4rf5 B: [277552]
   automated match to d2rhcb_
   complexed with gol, mg; mutant

Details for d4rf5b_

PDB Entry: 4rf5, 1.6 Å

PDB Description: crystal structure of ketoreductase from lactobacillus kefir, e145s mutant

PDB Compounds: (B:) NADPH dependent R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d4rf5b_:

Sequence; same for both SEQRES and ATOM records:

>d4rf5b_ c.2.1.0 (B:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
tdrlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvq
hdasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffg
trlgiqrmknkglgasiinmssisgfvgdptlgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatga
efvvdggytaq

Timeline for d4rf5b_:

• d4rf5b_ is new in SCOPe 2.05-stable
  
• d4rf5b_ appears in SCOPe 2.06
  
• d4rf5b_ appears in the current release, SCOPe 2.08