Lineage for d4rf4b_ (4rf4 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2847447Species Lactobacillus kefiri [TaxId:33962] [277547] (6 PDB entries)
  8. 2847457Domain d4rf4b_: 4rf4 B: [277551]
    automated match to d2rhcb_
    complexed with mg

Details for d4rf4b_

PDB Entry: 4rf4 (more details), 2.2 Å

PDB Description: crystal structure of ketoreductase from lactobacillus kefir
PDB Compounds: (B:) NADPH dependent R-specific alcohol dehydrogenase

SCOPe Domain Sequences for d4rf4b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4rf4b_ c.2.1.0 (B:) automated matches {Lactobacillus kefiri [TaxId: 33962]}
drlkgkvaivtggtlgiglaiadkfveegakvvitgrhadvgekaaksiggtdvirfvqh
dasdeagwtklfdtteeafgpvttvvnnagiavsksvedttteewrkllsvnldgvffgt
rlgiqrmknkglgasiinmssiegfvgdptlgaynaskgavrimsksaaldcalkdydvr
vntvhpgyiktplvddlegaeemmsqrtktpmghigepndiawicvylasdeskfatgae
fvvdggytaq

SCOPe Domain Coordinates for d4rf4b_:

Click to download the PDB-style file with coordinates for d4rf4b_.
(The format of our PDB-style files is described here.)

Timeline for d4rf4b_: