Lineage for d1d7fa3 (1d7f A:407-496)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 17288Fold b.71: alpha-Amylases, C-terminal beta-sheet domain [51010] (1 superfamily)
  4. 17289Superfamily b.71.1: alpha-Amylases, C-terminal beta-sheet domain [51011] (1 family) (S)
  5. 17290Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (10 proteins)
  6. 17324Protein Cyclodextrin glycosyltransferase [51018] (5 species)
  7. 17354Species Bacillus sp., strain 1011 [TaxId:1409] [51022] (3 PDB entries)
  8. 17357Domain d1d7fa3: 1d7f A:407-496 [27755]
    Other proteins in same PDB: d1d7fa1, d1d7fa2, d1d7fa4, d1d7fb1, d1d7fb2, d1d7fb4

Details for d1d7fa3

PDB Entry: 1d7f (more details), 1.9 Å

PDB Description: crystal structure of asparagine 233-replaced cyclodextrin glucanotransferase from alkalophilic bacillus sp. 1011 determined at 1.9 a resolution

SCOP Domain Sequences for d1d7fa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7fa3 b.71.1.1 (A:407-496) Cyclodextrin glycosyltransferase {Bacillus sp., strain 1011}
gstherwinndviiyerkfgnnvavvainrnmntpasitglvtslprgsyndvlggilng
ntltvgaggaasnftlapggtavwqyttda

SCOP Domain Coordinates for d1d7fa3:

Click to download the PDB-style file with coordinates for d1d7fa3.
(The format of our PDB-style files is described here.)

Timeline for d1d7fa3: