Lineage for d4rcxa_ (4rcx A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2078561Superfamily c.1.1: Triosephosphate isomerase (TIM) [51351] (2 families) (S)
  5. 2078925Family c.1.1.0: automated matches [191424] (1 protein)
    not a true family
  6. 2078926Protein automated matches [190605] (21 species)
    not a true protein
  7. 2079026Species Trichomonas vaginalis [TaxId:5722] [195009] (11 PDB entries)
  8. 2079036Domain d4rcxa_: 4rcx A: [277546]
    automated match to d3qsra_
    complexed with na

Details for d4rcxa_

PDB Entry: 4rcx (more details), 1.75 Å

PDB Description: trichomonas vaginalis triosephosphate isomerase tvag_497370 gene (ile- 45 variant) loop 3 deletion protein
PDB Compounds: (A:) triosephosphate isomerase

SCOPe Domain Sequences for d4rcxa_:

Sequence, based on SEQRES records: (download)

>d4rcxa_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfiflptlqqklrkdwkv
saenvftkpngtvpmiksfgiewtilghserrdilkeddeflaakakfalengmkiiycc
gehlsereagkasefvsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemc
kvirdilaakvgadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgfinivn
snvhsk

Sequence, based on observed residues (ATOM records): (download)

>d4rcxa_ c.1.1.0 (A:) automated matches {Trichomonas vaginalis [TaxId: 5722]}
mrtffvggnwkanpktveeaekliemlngakvegnvevvvaapfiflptlqqklrkdwkv
saenvfttvpmiksfgiewtilghserrdflaakakfalengmkiiyccgehlsereagk
asefvsaqiekmipaipagkwddvviayepiwaigtgkvastqdaqemckvirdilaakv
gadiankvrilyggsvkpnncnelaacpdvdgflvggaslepgfinivnsnvhsk

SCOPe Domain Coordinates for d4rcxa_:

Click to download the PDB-style file with coordinates for d4rcxa_.
(The format of our PDB-style files is described here.)

Timeline for d4rcxa_: