![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
![]() | Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) ![]() |
![]() | Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
![]() | Protein automated matches [190929] (8 species) not a true protein |
![]() | Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [277537] (1 PDB entry) |
![]() | Domain d2n74b_: 2n74 B: [277539] automated match to d1ns1a_ |
PDB Entry: 2n74 (more details)
SCOPe Domain Sequences for d2n74b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2n74b_ a.16.1.1 (B:) automated matches {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]} mdsntvssfqvdcflwhvrkrfadqelgdapfldrlrrdqkslrgrgstlgldietatra gkqiverilkees
Timeline for d2n74b_: