SCOPe 2.08: Domain d2n74b_: 2n74 B:

Lineage for d2n74b_ (2n74 B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein N-terminal, RNA-binding domain of nonstructural protein NS1 [47062] (4 species)

7. Species Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId:88776] [419762] (1 PDB entry)

8. Domain d2n74b_: 2n74 B: [277539]
   automated match to d1ns1a_

Details for d2n74b_

PDB Entry: 2n74

PDB Description: solution structure of the rna-binding domain of non-structural protein 1 from the 1918 h1n1 influenza virus

PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d2n74b_:

Sequence; same for both SEQRES and ATOM records:

>d2n74b_ a.16.1.1 (B:) N-terminal, RNA-binding domain of nonstructural protein NS1 {Influenza A virus (a/brevig mission/1/1918(h1n1)) [TaxId: 88776]}
mdsntvssfqvdcflwhvrkrfadqelgdapfldrlrrdqkslrgrgstlgldietatra
gkqiverilkees

Timeline for d2n74b_:

• d2n74b_ first appeared in SCOPe 2.05
  
• d2n74b_ appears in SCOPe 2.07