Lineage for d5do8a2 (5do8 A:478-553)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2810331Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 2810332Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 2810971Family b.71.1.0: automated matches [227134] (1 protein)
    not a true family
  6. 2810972Protein automated matches [226835] (41 species)
    not a true protein
  7. 2811128Species Listeria monocytogenes [TaxId:169963] [277527] (1 PDB entry)
  8. 2811129Domain d5do8a2: 5do8 A:478-553 [277534]
    Other proteins in same PDB: d5do8a1, d5do8a3, d5do8b1, d5do8b3, d5do8c1, d5do8c3
    automated match to d1uoka1
    complexed with bgc, btb, cl

Details for d5do8a2

PDB Entry: 5do8 (more details), 1.8 Å

PDB Description: 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase
PDB Compounds: (A:) Lmo0184 protein

SCOPe Domain Sequences for d5do8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5do8a2 b.71.1.0 (A:478-553) automated matches {Listeria monocytogenes [TaxId: 169963]}
gnyrlllpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpni
iegtlrpyeaivyqik

SCOPe Domain Coordinates for d5do8a2:

Click to download the PDB-style file with coordinates for d5do8a2.
(The format of our PDB-style files is described here.)

Timeline for d5do8a2: