Class b: All beta proteins [48724] (180 folds) |
Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) this domain is C-terminal to the catalytic beta/alpha barrel domain |
Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
Protein automated matches [226835] (41 species) not a true protein |
Species Listeria monocytogenes [TaxId:169963] [277527] (1 PDB entry) |
Domain d5do8a2: 5do8 A:478-553 [277534] Other proteins in same PDB: d5do8a1, d5do8a3, d5do8b1, d5do8b3, d5do8c1, d5do8c3 automated match to d1uoka1 complexed with bgc, btb, cl |
PDB Entry: 5do8 (more details), 1.8 Å
SCOPe Domain Sequences for d5do8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5do8a2 b.71.1.0 (A:478-553) automated matches {Listeria monocytogenes [TaxId: 169963]} gnyrlllpkdeaifayeryteneklvvlcnfteeeqvisdetilneiqkgsvlvnnvpni iegtlrpyeaivyqik
Timeline for d5do8a2: