Lineage for d5do8a1 (5do8 A:3-477)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2434695Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2438500Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2438501Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
    members of the family may contain various insert subdomains
    in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain
  6. 2439016Protein automated matches [190099] (33 species)
    not a true protein
  7. 2439138Species Listeria monocytogenes [TaxId:169963] [277525] (1 PDB entry)
  8. 2439139Domain d5do8a1: 5do8 A:3-477 [277533]
    Other proteins in same PDB: d5do8a2, d5do8a3, d5do8b2, d5do8b3, d5do8c2, d5do8c3
    automated match to d1uoka2
    complexed with bgc, btb, cl

Details for d5do8a1

PDB Entry: 5do8 (more details), 1.8 Å

PDB Description: 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase
PDB Compounds: (A:) Lmo0184 protein

SCOPe Domain Sequences for d5do8a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5do8a1 c.1.8.1 (A:3-477) automated matches {Listeria monocytogenes [TaxId: 169963]}
ekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqddn
gydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskdnp
yrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvynm
mkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemnqe
vtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiylpd
lkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgtpy
iyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpyqw
dnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiitt

SCOPe Domain Coordinates for d5do8a1:

Click to download the PDB-style file with coordinates for d5do8a1.
(The format of our PDB-style files is described here.)

Timeline for d5do8a1: