SCOPe 2.05: Domain d5do8a1: 5do8 A:3-477

Lineage for d5do8a1 (5do8 A:3-477)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.8: (Trans)glycosidases [51445] (15 families)

5. Family c.1.8.1: Amylase, catalytic domain [51446] (26 proteins)
   members of the family may contain various insert subdomains
   in alpha-amylases and closer relatives this domain is usually followed by a common all-beta domain

6. Protein automated matches [190099] (22 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [277525] (1 PDB entry)

8. Domain d5do8a1: 5do8 A:3-477 [277533]
   Other proteins in same PDB: d5do8a2, d5do8b2, d5do8c2
   automated match to d1uoka2
   complexed with bgc, btb, cl

Details for d5do8a1

PDB Entry: 5do8, 1.8 Å

PDB Description: 1.8 angstrom crystal structure of listeria monocytogenes lmo0184 alpha-1,6-glucosidase

PDB Compounds: (A:) Lmo0184 protein

SCOPe Domain Sequences for d5do8a1:

Sequence; same for both SEQRES and ATOM records:

>d5do8a1 c.1.8.1 (A:3-477) automated matches {Listeria monocytogenes [TaxId: 169963]}
ekdwwkksvvyqiypksfndsngdgvgdiqgiiekldylkelgvdviwlspvydspqddn
gydirdyqkiyeeygdmatfdqllqglhdrdmklvmdlvvnhtsdehkwfeesrkskdnp
yrdyyfwreeneinnwgsifsgpaweldektgeyylhlfskkqpdlnwenpklrqdvynm
mkfwldkgidgfrmdvinfiskntdfpdgpvpdgqiygdagndfcngpriheflqemnqe
vtskydvmtvgempgasttdaqiytnpannevdmiftfehmnldsdsdnkwdlkpiylpd
lkenmsewqvalqengwnslywnnhdqprivsrfgndnrfrvrsakmlatclhmmkgtpy
iyqgeeigmtnvhfetlddyrdietlnmykerkeqghshesimqsiytkgrdnartpyqw
dnsenagfttgtpwlkvnpryteinneealknpdsifyyyqnliklrktteiitt

Timeline for d5do8a1:

• d5do8a1 is new in SCOPe 2.05-stable
  
• d5do8a1 appears in SCOPe 2.06
  
• d5do8a1 appears in the current release, SCOPe 2.08