SCOP 1.73: Domain d1qhpa3: 1qhp A:408-495

Lineage for d1qhpa3 (1qhp A:408-495)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (5 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId:1422] [51021] (2 PDB entries)

8. Domain d1qhpa3: 1qhp A:408-495 [27752]
   Other proteins in same PDB: d1qhpa1, d1qhpa2, d1qhpa4
   complexed with ca, mal, so4

Details for d1qhpa3

PDB Entry: 1qhp, 1.7 Å

PDB Description: five-domain alpha-amylase from bacillus stearothermophilus, maltose complex

PDB Compounds: (A:) alpha-amylase

SCOP Domain Sequences for d1qhpa3:

Sequence; same for both SEQRES and ATOM records:

>d1qhpa3 b.71.1.1 (A:408-495) Cyclodextrin glycosyltransferase {Bacillus stearothermophilus, maltogenic alpha-amylase [TaxId: 1422]}
gtttqrwinndvyiyerkffndvvlvainrntqssysisglqtalpngsyadylsgllgg
ngisvsngsvasftlapgavsvwqysts

Timeline for d1qhpa3:

• d1qhpa3 first appeared (with stable ids) in SCOP 1.55
  
• d1qhpa3 appears in SCOP 1.71
  
• d1qhpa3 appears in SCOP 1.75
  
• d1qhpa3 appears in the current release, SCOPe 2.08