Lineage for d5dkvb_ (5dkv B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2912917Fold c.93: Periplasmic binding protein-like I [53821] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    parallel beta-sheet of 6 strands, order 213456
  4. 2912918Superfamily c.93.1: Periplasmic binding protein-like I [53822] (2 families) (S)
    Similar in architecture to the superfamily II but partly differs in topology
  5. 2913229Family c.93.1.0: automated matches [191439] (1 protein)
    not a true family
  6. 2913230Protein automated matches [190646] (77 species)
    not a true protein
  7. 2913254Species Agrobacterium vitis [TaxId:311402] [261009] (3 PDB entries)
  8. 2913257Domain d5dkvb_: 5dkv B: [277517]
    Other proteins in same PDB: d5dkva2
    automated match to d1guda_
    complexed with t6t

Details for d5dkvb_

PDB Entry: 5dkv (more details), 1.68 Å

PDB Description: crystal structure of an abc transporter solute binding protein from agrobacterium vitis(avis_5339, target efi-511225) bound with alpha-d- tagatopyranose
PDB Compounds: (B:) ABC transporter substrate binding protein (Ribose)

SCOPe Domain Sequences for d5dkvb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkvb_ c.93.1.0 (B:) automated matches {Agrobacterium vitis [TaxId: 311402]}
nkkfrialipglttdafyitmhkgaeaaaaaigaqiifqgapdfnpvtqvpvldaviakk
pdailiaptdttqlvqplkkaadagipmitvdtfigtgdyqtgagdgdfplsyiasdnvl
ggeiaarslalaigdkgkvyvsnvkpgvsttdqreqgfksemakhpgitvletqfndnda
nkaasqlqavyarnpdlagvfganlfsglgsangvqqagqsgtikvvafdapgsvvdnlk
sglidfaiaqhpaeigyygvisayahltgqsiptkigtgftvinksnvtdpavarfiyae

SCOPe Domain Coordinates for d5dkvb_:

Click to download the PDB-style file with coordinates for d5dkvb_.
(The format of our PDB-style files is described here.)

Timeline for d5dkvb_: